PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055186.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bHLH
Protein Properties Length: 239aa    MW: 26810.5 Da    PI: 7.2713
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055186.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH46.28.2e-1573125155
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   ++ +hn+ Er RR+++Ns +++Lr+llP a   + kKls  +++ +A ++I +Lq
  EcC055186.40  73 KKLNHNASERDRRKKMNSLYSTLRSLLPAA--DQMKKLSVPTTVSRALKHIPELQ 125
                   6789*************************6..49999***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.58372124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.5E-1473144IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.83E-1673142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000835.73E-1573129No hitNo description
PfamPF000103.5E-1273125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.7E-1178130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009561Biological Processmegagametogenesis
GO:0005730Cellular Componentnucleolus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MLSFSPSGWP LEGSTSQEQE SYMHRDAYTC YSPPLVHFPF LSPPTPSPLA EQAFDPLGIP  60
FGVVKDEEAT MVKKLNHNAS ERDRRKKMNS LYSTLRSLLP AADQMKKLSV PTTVSRALKH  120
IPELQQQVEK LTQEKEKLLS RINASRDGDY YTSHQEISTG EGALQILVPS ISATRLSESE  180
VAIQISTRKV MTHKTVDFSE VLLALDYLGF PVISSSTFES CGGMKTTFYN LHVQVLYHR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036348.11e-143PREDICTED: transcription factor ORG2-like
TrEMBLA0A059D2E51e-92A0A059D2E5_EUCGR; Uncharacterized protein
STRINGVIT_13s0047g00450.t019e-54(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.16e-46bHLH family protein